PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_D25CDC57D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 167aa    MW: 19468.3 Da    PI: 10.206
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_D25CDC57D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.54e-24959150
                           S---SHHHHHHHHHHHHHHHH.HHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                 SRF-TF  1 krienksnrqvtfskRrngil.KKAeELSvLCdaevaviifsstgklyeys 50
                           krien+snrqvtf+kRr+g+  KKA E+ vLCdaev v+ifss gkly++ 
  Traes_1DL_D25CDC57D.1  9 KRIENSSNRQVTFAKRRAGLVxKKAREIGVLCDAEVGVVIFSSAGKLYDFW 59
                           79*****************966**************************995 PP

2K-box66.31.1e-2278165188
                  K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                            yq++sgk l+++k++s + e++++kke++n+q e+Rh++Ged++sL+ keL  +e++L ++ ++ R+k +++++++ ++ ++ e+e++
  Traes_1DL_D25CDC57D.1  78 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQIELRHMKGEDVNSLQPKELIAIEEALTNGQTNLRDKMMDHWKMHRRNEKMLEEEHK 165
                            89999999************************************************************99999999999888888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-35161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.497162IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-272102IPR002100Transcription factor, MADS-box
CDDcd002654.44E-36287No hitNo description
PRINTSPR004043.8E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-211058IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-193960IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1489167IPR002487Transcription factor, K-box
PROSITE profilePS5129711.56291167IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT FAKRRAGLVX KKAREIGVLC DAEVGVVIFS SAGKLYDFWT  60
PKTTFAFAVR LPRILEKYQT NSGKILWDEK HKSISAEIDR VKKENDNMQI ELRHMKGEDV  120
NSLQPKELIA IEEALTNGQT NLRDKMMDHW KMHRRNEKML EEEHKLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-16193178Myocyte-specific enhancer factor 2B
1tqe_Q4e-16193178Myocyte-specific enhancer factor 2B
1tqe_R4e-16193178Myocyte-specific enhancer factor 2B
1tqe_S4e-16193178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1079911e-162AB107991.1 Triticum aestivum WPI1 mRNA for PISTILLATA-like MADS box protein, complete cds.
GenBankAM5028801e-162AM502880.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM14 (WM14 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568421.11e-102PREDICTED: MADS-box transcription factor 4-like isoform X1
SwissprotQ407031e-103MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLW5AIP51e-121W5AIP5_WHEAT; Uncharacterized protein
STRINGMLOC_44514.11e-110(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.14e-60MIKC_MADS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]